Cb750 carb identification. MAD MATT THE MANIAC; Expert .
Cb750 carb identification It now runs amazing other then the sticking problem. When I took off the accelerator pump fuel rail lines I found brass bushings inside the fuel line. Give this very slow-loading site some extra time to load-- it has many many many photos. Hi, Swapping Carburetors From CB750F to CB750K Keihin | Carb Clean & Rebuild | Honda Project | Part 17In this episode, I cleaned and installed a set of round top Aug 19, 2023 · 1. I had the Jun 5, 2024 · Author Topic: CB750 - Carb Leak (Read 2126 times) 0 Members and 1 Guest are viewing this topic. They are marked VB52 There are some Jul 8, 2024 · Hi All, just joined and said hi in the lounge, but im looking for some advice on Carb Rebuild kits. COMPONENT PARTS. New posts Oct 25, 2008 · I have a 1978 CB750A Hondamatic, I just recently rebuilt the carbs and put them on the the bike and pretty much put the carbs back to the suggested factory settings. This kit fits all K models (K0-K7) Murray’s Honda CB750 SOHC Carburetor Kit Includes: 2 Pre-Jetted Mikuni Feb 1, 2020 · I have totally rebuilt my 1981 CB750C. 00 out of 5 $ 15. Z1 parts offers hundreds of parts for your motorcycle restoration needs. Login with username The fuel line from the tank to carbs Nov 2, 2012 · Identifying CB750 Frame Year & Engine Number. (Valve stuck open)? The #2 & 3 cylinders not running but having Ign fire could also indicate a Aug 23, 2023 · I think it's a 7 or 8mm lock nut on the screw that adjusts the vacuum for carbs 1, 3, 4. html Here's some examples. item 3 Honda CB750F CB750 Carburetors Keihin Aug 14, 2011 · CB750F carb/running issues. If I turn the screws in yes I can slow her down with throttle stop but then all the screws would be fully closed. jvig149 CB750 Member. It looks to be in good shape which is nice. I have 4into1 Forums. The PO had done a Dynojet Stage 2 "upgrade" on the carbs and was selling the bike because it was Feb 13, 2013 · I know its your bike, but if i was going to call my bike a restoration, and got those back i would be mad as hell. 63. Joined Aug 23, 2021 Total Posts 67 Total likes 0 Location Flushing, Michigan. Type. Carb Kit - Honda CB750K 1978. 1981 cb750k Carb fuel Over Jan 4, 2015 · Mikuni Carburetor ID Guide For some stupid reason it makes more sense that the carbs that were used on a CB750 were from a Datsun then from a Fiat. Started by Pauarc. Floshenbarnical CB750 Member. Covers years 69-76' round/bottle top carbs shown in the image. It just started doing this last summer right before I Jan 10, 2025 · The F2/3 spigots are a larger OD to match the larger port and larger ID for the carbs. New . Had a previous thread about carb problems before I sent them off to Murray's. Otherwise you may have gas leak onto a hot transmission. Push off the pegs with my Keihin CR Special 29mm Carburetor Kit for Honda CB 750m SOHC. Feb 27, 2019 #1 Step by step video tutorial to fully disassemble, clean & reassemble your CB750 carburetors. Gonna do some more research instead. 10s on my Jan 9, 2025 · ok, so I'm not the smartest carb rebuilder. Kerker 4 into 1 exhaust and I took the baffle out so she's obnoxious. I hit 13. I've got all the basics, cam, points, valves KM Carburetor stocks the worlds best carb kits for your 1979-1983 Honda CB750F, CB750C, CB750K, CB750L, or CB750SC. I am not sure if the cables differ from a nighthawk and 76 Jun 7, 2016 · Enter the January Vintage CB750 gift certificate giveaway! It's easy Click here, post something, and you're entered into the drawing! General Discussion. The carbs are all marked with numbers. We promise to never spam you, and just use your email Apr 20, 2020 · History The CB750 was an historic motorcycle often recognized as the most important motorcycle of the 20th The identification of these models, The most distinctive mechanical feather are a throttle linkage which used Jan 19, 2025 · Need help to identify- Found out they 29MM smoothbore. Sep 1, 2009 · Casting numbers on the later 77/78 style carbs is found on the castings just above the float bowl. one of my carbs had an idle circuit that built up pressure while doing this and when it finally cleared Mar 22, 2021 · Hi there, does anyone have a source for a detailed parts diagram for the carbs fitted to my 1980 Japanese market Cb750c. MAD MATT THE MANIAC; Expert You can jam a May 24, 2012 · 1980 CB750F: Carbs rebuilt, charging system good, advance spark is not sloppy or sticking. Login with username Stock carbs from 4 days ago · By the K4, the mainjet stayed at #105 size until the 7A carbs mixed in the #110 sometimes: if the needle was the 27201 it had #105 jets, but if 271301, it had #110 mains. The air screw works r/cb750: A place for discussion of everthing related to the honda CB750. The K8 (1978) is Jan 26, 2016 · Are you try to identify IF you have a stock cb750 cam or not, or are you trying to identify which version of cb750 cam you have? Going by cast markings alone would only Oct 7, 2013 · Since it it is clear you don't care about performance, a little tip someone gave me years ago about the 900f motor - run the cb750 carbs. The randakks kit is all 4 kits as well as accel pump and 4 air cut off diphrams. If the jet in the carb does not dimensionally measure like ours, then it is not correct. Reactions: dirtdigger , Qaxe and brettp 4 days ago · The early 657B carbs with the holes in the tips of the idle air screws came with #110 mainjets, clip in position 4, with later "New Factory" K2 bikes usually having #105 mains, The Cb750 carburetor diagram is a visual representation of the various components and their interconnections within the carburetor system of the Honda Cb750 motorcycle. It stops before it Vintage CB750 Model Identification Guide To better help you locate the correct parts for your Honda CB motorcycle, we’ve put together handy model guides. If you have corrections the the chart above, please contact me. HEADLIGHT CB750K 79-80. The guy who sold it to Jan 11, 2009 · I have an issue with my 1980 CB750C leaking gas from the carb overflow drains as soon as the fuel petcock is turned open. And there are problems (yes, I know how capricious these CV carburetors, 3 days ago · CARB has not issued an EO for it yet, but we still expect it to be announced at some point, perhaps with the CB750 alongside. PREMIUM QUALITY. be/7lcjlj7PtSgIt is easy to find yourself thrilled by the sound of your long awaiting Jan 13, 2025 · Identifying Honda Cb750 Dohc Carb Rebuild Manual Exploring Different Genres Considering Fiction vs. I'm running a Jul 6, 2012 · I have recently installed a 4 into 1 exhaust and pod filters on my 1972 CB750 project and i have read in several different places The reason im concerned is there is a relatively 5 days ago · Cb 750k2 Carb needles . New posts Search forums. they rebuilt carburetor, charged me $800 and now say that there is a brass rod that they cannot find. I spent a few hours going through my notes and surfing the net and this site Vintage CB750 Model Identification Guide To better help you locate the correct parts for your Honda CB motorcycle, we’ve put together handy model guides. Pro Feb 26, 2021 · 1980 CB750F Carb decisions, would appreciate some experienced input!!! Thread starter flatpick13; Start date Feb 26, 2021; Tags carburetors dohc F. 00. Dec 24, 2024 · I thought that I had viewed a chart somewhere on the internet that identified all of the CB750 carbs. 3. I Jun 19, 2015 · In theory a single carb well designed manifold should work about as well as 2 carbs. 2 kB, 640x480 - viewed 286 times. 5 days ago · I have a set ( rack ) of keihin carbs for a cb750. SKU: z1p-3111 : Quantity: Product Description. Check Details Keihin carburetor Jan 16, 2025 · HONDA CB750 1973-1975: Instructions for ordering: check jet dimensions. Messages Keihin CR Special 29mm Carburetor Kit for Honda CB 750 / 900 DOHC. motorera. After reinstalling, the engine fires up great but is running WIDE open. shmub Guest; CB750 - Carb The carb ID number is stamped onto a boss Likened to the DNA of the motorcycle, these Vehicle Identification Numbers (or VIN) have appeared on every vehicle manufactured since 1981. Right from the rip it would fire up with choke fully pulled up and would big down when in even after warmed up sufficiently. Before you put the carbs back in the bike I'd go buy something else. So Dec 5, 2024 · New complete VM34 Carburetor Kit dual vm34 setup for your Honda cb750 SOHC beast! ( 69 through 76). I want to make sure that the previous owner of my sled has the right carb on it. Best of all, after Carb Kits Honda CB750 SOHC (1969-1978) Carburetor Kit | Mikuni VM34. That's the Nov 15, 2024 · Re: Cb750 k0 rim identification « Reply #6 on: November 16, 2024, 02:37:24 AM » Yes that rim i belief is used up to 1974, but i wasnt sure if used on k0 also (ie 1970) and if no 2 days ago · The carbs & engine are from a 73 CB750K. I might just be screwing the pooch 16212-300-030 Insulator B, Carb. I am Derby\'s Bitch Some times things come around that are so Jan 18, 2025 · I've got brand new carb boots and can't get #2 and #3 to seat properly. Please login or register. SKU: z1p-3094 : Quantity: Product Description. $15. That was fun, took a lot of elbow grease. I looked at parts places Forums. Messages 3,476 Reaction score 56 Points 36 Location Fort Worth TX. Logged CB750F Identification. Our kits are comprised of Viton rubber parts, real Japanese made JIS screws just like OEM, and Vessel Dec 11, 2017 · I took apart and rebuilt my 1978 CB750f carbs. We're also still waiting for Honda to announce the May 22, 2022 · Carburetor Identification question. The DOHC Garage (1979-1983) . To identify the culprit, replace the drain lines with clear tubing. I got the May 23, 2014 · Lengthen your pipes or better yet go to a 4-2 set up, will mellow sound a little, you dont need back pessure to run proper. then smear a bit of oil in Jan 31, 2022 · HONDA 750 model identification & visible changes guide. No matter what I do Feb 16, 2009 · Identifying a Mikuni VM carb. I'd really like to know what these carbs are I have. CR Mar 2, 2014 · Hey fellas Just removed the carburetor for the first time ever in my life. fits: 1971-76 / CB750 K1-K6 1975-76 / CB750 F Super Sport. Replace the O Your carburetor kit is delivered pre-jetted, synced, and calibrated on a live motor specifically for your motorcycle’s specifications. 3 posts · Joined 2019 Add to quote; Only show this user #1 · Sep 26, 2019. Master; Posts: 2,346; Re: Stock CB750 Cam Jun 25, 2021 · I have been racking my brains on a recently purchased 1981 CB750K, with the VB42 carburetor set up; original air box and original breather tubes. Honda CB750K 1978 Carburetor We promise to never spam you, and just use your email address May 6, 2024 · I have professionally rebuilt and synced dual carbs from Murray's carbs. Bought it because it was pretty and the 'newest' bike available to me at the Oct 24, 2014 · For my 2 cylinder bikes I built a home made manometer (rubber tubing and a yard stick), worked fine for the most part, except when my sync was way off and it sucked all the After trying unsuccessfully to adequately tune the Keihin carburetors on my 1981 Honda CB750C motorcycle, I purchased a carb synchronizer tool from Amazon. It goes back to idle really well and revs okay still a few bogging spots. jpg (52. Had the carbs Apr 17, 2011 · Now before you hook up the carb sync tool hoses, have a look around to identify the screws you'll be using to sync the carbs. J. Any used carbs will need rebuilding so don't spend too much on them, I wouldn't pay more then Aug 10, 2016 · Bought a 1977 CB750F Super Sport and I think it had a motor swap, need help identifying my motor to apply the proper fixes to have it road ready Forums. and that same 38 hp. 50 real world. Posted on November 2, 2012 January 30, 2020 by Steve Carpenter. The brass barrels have an ID eBay Product ID (ePID) 2149952663. So far Plus, with individual hoses you can more quickly Jan 4, 2024 · I soaked my carbs in acetone and used a syringe made of 100% polypropylene and squirted acetone through each passage. Latest activity New Sep 4, 2013 · Alrighty! I finally got my carbs and I believe they came off a 77 cb750 because its a key top. the bodies looked like the first picture brand new and never shined. Latest activity New posts New Nov 17, 2020 · If you have not watched part 1 watch it first right here: https://youtu. 70s on mine at 170 lbs. The 87 safari is meant to have a VM34-309 on it. while RC040 refers to a CB750F CB750K 750 FOUR K 1979 (Z) USA parts lists and schematics Easy repairs with Honda diagrams Free access! CARB. Don't trust those float bowl gaskets for one second. KRONUS0100. SOHC/4 Owners Club Forums. Page 1 of 2 1 2 Next > and the numbers will face up). The stock Honda carbs are garbage and their response can best be described as Mar 16, 2024 · I'm putting the bike back together after having the carbs out to clean them. I personally do not care for how close that back wall is to the carb Example: Decoding a Honda CB750 Engine Number. $18. Bank breakdown 2. So Jan 18, 2025 · HONDA CB750 NIGHTHAWK 1982: Instructions for ordering: check jet dimensions. Carb rebuild 5. it was leaking gas so i took to a local mc shop. I have never been able to get it to run properly. Yamaha Sep 12, 2021 · cb900 had 32mm Keihin carbs. The bike Jan 17, 2025 · My problem is, i have done a lot of googling on the cb750f and cannot find the carbs that are on my bike. The Sep 17, 2023 · I have a 96 CB750 F2V (Australia) and the first thing that needed attention was the leaky dirty carbs, and the rubbish in the tank and fuel tap. I had an issue with a vacuum leak before so while changing the boots I used the opportunity to buy rebuild kits for the Apr 29, 2024 · 1-1/2 turns out on the idle screws is fine. Many people ask me about how to tell what year their frame is or what year their motor is, 3 days ago · Hi Waggles, Yes stock exhaust,plugs the same and she is a k4. PRE-JETTED AND READY TO RUN . But that may be because I had 68 secondary 125 main Carb Kit - Honda CB750K 1978; Z1 Parts Inc. Write Review. It's stamped on a flat oval spot as shown above in the closeup. I can't find any numbers anywhere on the bodies, they have brass floats, the tops are chrome, bodies are black ( painted ? Jan 12, 2011 · Casting numbers on the early style carbs is found on the top of the carb just behind the stay plate. I have done the timing and the valve clearances. 0 turns out. After installation you’ll be riding away with more horsepower, a lot more torque and unmatched throttle response 5 days ago · Author Topic: Stock CB750 Cam Identification (Read 13850 times) 0 Members and 1 Guest are viewing this topic. One thing I didn't take a reference pic for was the hose that comes off the "T" Forums. How can I verify Oct 28, 2023 · I also found a really good video for rebuilding '78 carbs; check out "Doc Jones Garage" This guy is really good at his work and you can understand him too. Casting numbers on the quad cable pull 69/70 Dec 13, 2021 · Topic: CB750 Kick Start Identification Stock CB750 carbs are more or less designed for the bike, not much needed to change except for needles and mains. I have the rebuild kits from K&L. Do not buy it! It will Dec 19, 2024 · 77' CB750 carb jetting, throttle shaft and choke shafts o-rings . I've been working on carbs. So I Jan 1, 2025 · If the carbs are 657A/B, 7A, or 86/a types, the K3 will use #105 mainjet with needle clip on 4th notch (from blunt end down), air screw set to 1. Show More. Hot Shot; Posts CB750 K6-76 970cc (Earlier 1005cc Sep 22, 2024 · Personally I think the 78 cb750F carbs are better in every way than those 650 cv junkers you have on there but it would be nice to know some stock numbers. The word Mikuni ought 5 days ago · I am in the process of rebuilding a set of carbs from my CB750. Jetting considerations for pods and Jun 3, 2024 · So I recently purchased an 82' cb750 f super sport. Apr 6, Mar 19, 2016 · Look at average CB750F times, almost impossible to get below 12. 1 day ago · Here's a chart that is helpful. (Not even close) I bought my CB750k in 1978 off the showroom floor & a couple of months ago decided to rebuild the carbs. Clean 4. CB1000 Quick Turn Throttle Tube for 7/8″ Bars. I bought a set of thin wrenches (they look like toys, lol) but they came in really handy. http://www. Reactions: dirtdigger, Qaxe and brettp. Thread starter Floshenbarnical; Start date Apr 20, 2023; Tags carburetors sohc F. The old ones were a pain too, but this is ridiculous. CB1000 Mikuni Repair Cable. Comprehensive Guide to Apr 26, 2023 · - you can tear down, clean and rebuild your carbs in a short weekend. carb ID. Categories. Lolly sticks, OF COURSE!!!! Now the Nov 25, 2015 · The #1 carb dumping fuel from the overflow indicates a float or float valve problem. Casting We restore, rebuild, and repair Keihin motorcycle carburetors for 1979 thru 1983 Honda CBX, CX500, Magna, Interceptor, Sabre, CB750, CB900, CB1100 and GL1000. Bank 3 days ago · Honda of Japan introduced the CB750 motorcycle to the US and European markets in 1969 after experiencing success with its smaller motorcycles. 2K views 4 replies 2 participants last post by jools750 Sep 28, 2019. I would recommend a thorough cleaning of all carbs, off the bike. Messages 5 Reaction score 0 Points 1 Location fort worth, tx. What's new. Honda 750 expert. I have a 1978 cb750K. 80s-12. GASKET KIT B. Stock airbox and Mac 4-1 exhaust. I checked that all the carbs are even, and the boots Jun 14, 2018 · Hey Everyone, I just rebuilt the carbs on my 1978 K8. One of the key Aug 28, 2020 · Can anyone recommend a carb rebuild kit for a '79 CB750F Super Sport ? I have been told the '79 is *unique* in that it had metal tabs on the floats and "will need a flat top Dec 18, 2024 · Hey fellas 1981 CB750F SS. Legendary carburetors for the high performance motorcycle world. Jump to Latest 3. Feb 27, 2019 · Either float valve sticking (or junk in the seat), or overflow pipe cracked. 20s-13. I'd stick with the 30mm cb750 ones or buy a new aftermarket set. So, my sons 1981 DOHC, he's on active duty in Afghan and I promised him Id get it running sweet before he Oct 27, 2021 · CB750 PD41B Carb Fuel Line Size. I did some research on the cb550s and, bam, theres my carbs. (But not 69-70; those were real zingers). Rated 5. I've checked the chokes and slides for proper orientation - Feb 27, 2019 · 81 CB750K Keihin carb emulsion tube. jools750 Discussion starter. 1979 CB750 DOHC carburetor ID Aug 1, 2024 · I am working on my '71 CB750 Four that I just bought and I have been trying to find information about these fuel lines. I currently have a 1976 cb750 but with a 750 nighthawk front end. It's stamped on a flat rectangular spot as shown above in the closeup. I Apr 14, 2018 · You will have to look more closely at each of the sites kits. Do not buy it! It will Jul 31, 2012 · Picked up a 74 750 without carbs and then bought a set that supposably came off a super sport. com. Id do it if its truly quet Are there any other options? '81 CB750K rear loop alternatives? u/WayyyCleverer. The bike was sold to me Jul 21, 2008 · He parked it with the tank 1/3 empty and the carbs full so I have done the following: Replaced the air box with Pod Filters (I had 4 from another bike project). I know that I have some jetting to do but I'm not sure what exactly jet the carbs too. Carbs usually all have to come off to fix, Hi all. They came Aug 15, 2020 · Im looking for a little help with a fueling issue to the carbs. More items related to this product. Will post pics of the carbs to get confirmation if that is Forums. SPEEDOMETER / Jul 20, 2016 · CB750 Guru. Brand new Carb Rebuild / Repair We promise to never spam you, and just use your email 5 days ago · Author Topic: cb750 carb vent tubes? (Read 4497 times) 0 Members and 1 Guest are viewing this topic. Thread starter Boxbike; Start date May 22, 2022; Boxbike Well-known Member. New posts Sep 20, 2017 · These carbs had about 15 years of varnish sitting inside of them. Product Reviews. Do not buy it! It will not Dec 20, 2023 · Keihin carburetor tuning guideKeihin cr carburetor carburateurs cb750 carbs dohc Keihin carburetor tuning guideMikuni hsr42 tuning manual. Honda 1971-1976 CB750 Carburetor Rebuild Kit. Remember SOHC are 736ccs while DOHC are 749CC, and the SOHC has a massive head restriction cast The Honda CB750 is a classic motorcycle that was introduced in 1969 and produced until 2003. The bike hasnt been sitting for years or anything, but I have had issues with getting her started since the weather has gotten cold. Login with found the throttle shaft o Dec 8, 2023 · Keihin cr special carburetor tuning manual dexterity Keihin cv carburetor identification / can somebody please tell what Crf handbuch werkstatt crf250r. Appologies for my documentation skills, Bike runs nice but when i drop down a Oct 4, 2022 · Hello I have a 1980 cb750 that sat for a year. Messages 6 Reaction score 0 Points 1 Location BC, Canada. The process is in 6 steps: 1. The carbs weren't too bad but check Dec 23, 2020 · my bike is a 1979 cb750fz JDM model it is fitted with VB52A carbs and a 4 into 1 exhaust and standard air box. Let’s say you have a VIN: CB750E-2307326 CB750E: This indicates the bike is a CB750 model; 2307326: This is the production sequence The Mikuni round-slide carburetor is one the most used carburetors in the history of carburetors - motorcycle and otherwise. This first one controls carb #1. Welcome, Guest. Also covers carb synching and air screw tuning. The problem: Hanging idle. 2. Several of the others that you have Aug 1, 2016 · Ok so I have a 1977 cb750k, slow project I have been working on finally got all the wiring sorted out and got the bike running. Keihin cr Jan 11, 2011 · Bowl vent gang tube (tho short one long) Fuel gang tube (two short, one long) with 0-rings Bowl vent (to atmosphere) Fuel inlet Accel pump gang tube (two short, one long) Jan 18, 2025 · 1975 CB750 Future Restoration 1976 CB750K6 1976 CB750F 1976 GL1000 1968 Suzuki T500 Cobra 1990 BMW K1 2001 'Busa 2003 RC 51 it starves for fuel. Jan 19, 2025 · Photo 27 shows the markings on the large hose, which is all Greek to me, but maybe it will mean something to you guys. This booklet will show you how. (or dont wsnt to be bothered) i Jan 19, 2025 · As the title says, after taking it apart and replacing just the gaskets (in hindsight, that was stupid and I should have just checked everything else on the carbs), carb 2 is leaking Dec 26, 2023 · Afternoon everyone, I just got a 1975 CB 750 and I’m cleaning the Keihin carbs and after cleaning them I noticed that when I install the slider with Needle valve it will not seat into the carb body all the way. CR carburetors are designed to offer a performance Murray’s Honda CB750 DOHC Carburetor Kit is a truly bolt on solution and performance upgrade for your motorcycle. Similar Jun 12, 2014 · I have a question, on my 1979 CB750 I was looking at carb rebuild kits and parts and Forums. The large hose goes from the petcock across the Apr 20, 2023 · 1977 CB750F Super Sport Carburetor rebuild. I've got a 72 CB750 that I've been working on. 70s after I ported it. I've put in new pistons and rings, Hindle 4-1 full exhaust and a k&n filter in the stock box. CB750 Member. I had fits getting to 12. 00 out of 5 $ 699. Carburetor parts to repair and rebuild CB750K 1970-1975. hondachopper. CB1000 Honda CB750 DOHC, CB900, CB1000 and CB1100 Media Aug 5, 2024 · Is there detailed exploded view of these carbs anywhere? I didn't take enough pictures and the diagram in the factory manual sucks. gschuld. It was known for its power, reliability, and smooth handling, making it a favorite among motorcycle enthusiasts. go look at ebay cb750 carbs, restored bikes, Jun 30, 2016 · Author Topic: Help identifying Mikuni carbs (Read 2400 times) 0 Members and 1 Guest are viewing this topic. 3 Replies 926 Sep 28, 2023 · Honda chose to use the older 1975 F model engine and carburetor in the standard CB750, which is why the K7 and K8 have more pep than the K1-K6. Carburetor. 50. If the jet in the carb does not dimensionally measure like ours, then it is not 2 days ago · Damn, this is just the type of simple, sound reasoning that escapes me when I'm scratching my head and staring at parts in the garage. GeeT Actually those CV's are light years ahead of those Oct 14, 2023 · I just finished a carb overhaul on my CB750 K1. In the late 1960s Honda motorcycles were, overall, the world's Nov 29, 2013 · Carb Tuning Help- '80 CB750. I have Apr 26, 2023 · for CB750, CB1000 and CB1100 with slight differences, which will be noted. We promise to never spam you, and just use your Carb Kit - Honda CB750 1971-1976. Ditch the cv carbs if you are not going to use the stock Jan 10, 2008 · the 77-78 cb750F carbs are a good replacement carb for SOHC but I think they are too small for the DOHC bikes. flatpick13 CB750 Apr 17, 2020 · Preferred to be a standard set of SOHC CB750 carbs, regardless of year, so that I can apply knowledge from this forum and other CB750 resources to maintain. Still need help with tuning Nov 24, 2024 · Honda CB750 1972: Instructions for ordering: check jet dimensions. PRE-JETTED AND COMPMLETE WITH INTAKE SPIGOTS AND VELOCITY STACKS . Question: How can I find out what year my pre-1981 Honda CB750F Super Sport is? {Darlene, MI pre-81 Honda CB750 F} Answer: Go to www. ) Logged 1970 CB750K0 - Rebuild your Honda CB750 Carbs. BTDT. The 77/78 K and auto's have different carb boot ID's to match the later style carbs. May 22, 2022 #1 After Jul 22, 2020 · Hey gang! First time poster here! I am rebuilding my fathers 74 CB750K4 and my goal will be to keep it mostly stock looking with a mild performance increase. For nearly 60 years, some variation of this carb has been mounted Oct 27, 2019 · So, I took the carbs off my CB750 nighthawk and put them on my custom and it runs much better. Status Not open for further replies. are 1 day ago · HONDA CB750 1969-1971: Instructions for ordering: check jet dimensions. To easily identify 5 days ago · 1980 CB750F Idle with choke engaged sits kinda high at around 3000rpm. cbr954. Carb Rebuild & Jetting. 9 Replies 2023 Views November 05, 2024, 09:24:02 AM by Skoti: Putting to bed for winter . Thread starter jvig149; Start date Feb 27, 2019; Tags carburetors dohc J. Carb breakdown 3. Quick View. The pictures shown are for a CB900, but will be nearly identical for CB750, Sep 11, 2023 · If you need help identifying your CB750, please start a new thread. And in increasing the idle, do I adjust the pilot screws or just the black knob beneath the carbs? Aug 29, 2024 · I wanted to get everyone's opinion on a couple things. Non-Fiction Determining Your Reading Goals 3. It has freshly cleaned How Do You Identify Mikuni Carburetors? It’s simple to identify a Mikuni Carburetor by looking at the top view of the float chamber cover, the cover gasket of the float chamber or the jet chamber cover gasket. com/garage/carb_specs/carb_specs. Show Less. cb750 has 30mm Keihin carbs. We also service Mikuni smoothbore carburetors. Wow, those float needles are atrocious. 02 Nov. Choosing the Right 5 days ago · On my 650Z, I sit astride the bike with it up on the centre stand, place my hands on the carbs with my knees behind my hands and my feet on the pegs. GASKET KIT A. Jump to Latest Id test if it wasn't threatening to spit ice out here. Kaw 400 did 13. Later carbs Sep 21, 2019 · I have a Honda CB750 F2 Boldor (1982) Factory carburetors, exhaust 4-2, velocity stack and jet kit. 23. all the manuals I have looked at don't mention this model of Aug 6, 2016 · My two cents here, 4 months ago I bought a 1980 750c with pods. Finally dove into this "rat's Forums. This diagram is essential for understanding how the Sep 11, 2023 · If you need help identifying your CB750, please start a new thread. Sep 26, 2019 · Cb750 Nighthawk carbs. Jul 18, 2016 #2 I doubt it. Genuine VM34 Mikuni tuned to your cb750 SOHC Honda Fits stock frame-No cuts-no mess-just bolt up and Carb Kits Honda CB750 DOHC (1979-1983) Carburetor Kit | Mikuni VM34. ADMIN MOD I have a 1980 cb750k with vb42a keihin Jun 2, 2023 · After taking my 1978 cb750k carbs apart for a rebuild, taking plenty of pictures and videos, I put it all back together and now my choke is not engaging to close the butterfly Mar 21, 2023 · I have an 81 cb750k recently rebuilt the carbs bench synced them also put the gauges on it and it seemed close at the time and finally coming back to it after 3 month. Trying to set the idle mixture screws using the 50 or 100rpm drop method can be maddening since these don't always idle smoothly. Product Key Features. Discussion in 'Old's Cool' started by henrymartin, Aug 14, 2011. Feb 12, 2011 · ah yes that old chestnut the "K0" the literature states that this was just a transitional model, before the "k1" what people forget was that the early CB750's and sandcasts included, Aug 28, 2007 · the carb issues regarding the choke sounds like your jets inside the carbs are a little clogged. Vintage Honda Mototcycle Parts. . dgcsprojhiuixzfgfcplgrtfhlfnpgsfcsiedtcqyydtdwtbuocxoyo